SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044100 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044100
Domain Number 1 Region: 6-412
Classification Level Classification E-value
Superfamily Ras GEF 5.49e-101
Family Ras GEF 0.00028
Further Details:      
 
Domain Number 2 Region: 483-543
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.28e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00099
Further Details:      
 
Domain Number 3 Region: 417-496
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000204
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044100   Gene: ENSBTAG00000008006   Transcript: ENSBTAT00000046852
Sequence length 691
Comment pep:known chromosome:UMD3.1:11:16087064:16134216:1 gene:ENSBTAG00000008006 transcript:ENSBTAT00000046852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSGLGKAATLDELLSTCIEMFDDNGELNNSYLPRIVLLMHRWYLSSTELAEKLLCIYR
NASGESCDEFRLKICYFMRYWIVKFPAEFNLDLGLIRMTEEFREVASQLGYEKHTSLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMMELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNLDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSPTSPTTPTKPVVPLEWASGVMPKPDPTVINKHI
RKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRA
KSQLHCKMGPGFVHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLV
LACRRFARAPSLGSSHGSLPGSPSLPPVQDEVFEFPGVTAGHRDLDSRAITLVTGSSGKI
SVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMRSKFHDKAAKDKGFAKWENEKPRVQ
AGVDVVDRGTTFEPDQDEADMDETKQDGEDG
Download sequence
Identical sequences Q0VD52
ENSBTAP00000044100 ENSBTAP00000044100 NP_001069316.1.59421 NP_001069316.1.76553 XP_005212591.1.76553 XP_015328896.1.76553 XP_015328897.1.76553 XP_015328898.1.76553 XP_019825538.1.53367 9913.ENSBTAP00000044100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]