SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044105 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044105
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily EF-hand 1.71e-25
Family S100 proteins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044105   Gene: ENSBTAG00000033007   Transcript: ENSBTAT00000046857
Sequence length 101
Comment pep:known chromosome:UMD3.1:3:17086462:17089235:-1 gene:ENSBTAG00000033007 transcript:ENSBTAT00000046857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFHLEQAITDLINLFHKYSGSDDTIEKEDLLRLMKENFPNFLSACEKRGRQYLSDIFE
KKDKNKDKKIDFSEFLSLLADIATDYHNHSHGAQLCSGGNQ
Download sequence
Identical sequences E1BKA1
ENSBTAP00000044105 XP_002686048.1.76553 XP_005197767.2.59421 ENSBTAP00000044105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]