SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044226 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044226
Domain Number 1 Region: 59-147
Classification Level Classification E-value
Superfamily EF-hand 6.55e-25
Family S100 proteins 0.0000622
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044226   Gene: ENSBTAG00000005163   Transcript: ENSBTAT00000046984
Sequence length 150
Comment pep:known chromosome:UMD3.1:3:16812602:16816588:-1 gene:ENSBTAG00000005163 transcript:ENSBTAT00000046984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RETPKTKLFTEESPPRGRTAEDRSSCTAPGATFAASSACPEPAPRLTAGNPRVSFEMGSE
LETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDADAVDKVMKELDE
NGDGEVDFQEYVVLVAALTVACNNFFWENS
Download sequence
Identical sequences H9KUV1
ENSBTAP00000044226 ENSBTAP00000044226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]