SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044276 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044276
Domain Number 1 Region: 5-181,217-364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.2e-93
Family G proteins 0.000000588
Further Details:      
 
Domain Number 2 Region: 690-698,735-902,961-990
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.57e-32
Family Translational machinery components 0.0098
Further Details:      
 
Domain Number 3 Region: 993-1105
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.11e-30
Family EF-G/eEF-2 domains III and V 0.00052
Further Details:      
 
Domain Number 4 Region: 405-421,501-607
Classification Level Classification E-value
Superfamily Translation proteins 1.59e-19
Family Elongation factors 0.0015
Further Details:      
 
Domain Number 5 Region: 614-688
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 7.91e-19
Family EF-G/eEF-2 domains III and V 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044276   Gene: ENSBTAG00000003410   Transcript: ENSBTAT00000047037
Sequence length 1129
Comment pep:known_by_projection chromosome:UMD3.1:21:24407756:24520671:-1 gene:ENSBTAG00000003410 transcript:ENSBTAT00000047037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLNSLDKMIQLQKNTANIRNICVLAHVDHGKTTLADCLISSNGIISSRLAGKLRYMDSR
EDEQVRGITMKSSAISLHYAEGDKEYLINLIDSPGHVDFSSEVSTAVRICDGCIIVVDAV
EGVCPQTQAVLRQAWLENIRPVLVINKIDRLIVELKFTPQEAYSHLKNILEQINALTGTL
FTSKVLEERAEREAESQVNPNSEQGEQVYDWSTGLEDTDDSHLYFSPDQGNVVFTSAIDG
WGFGIEHFAKIYSQKTGIRKEVLLKTLWGDYYINTKAKKIMKVDQAKGKKPLFVQLILEN
IWSLYDAVLKKDKEKTDKIVTSLGLKIGAREARHSDPKVQINAICSQWLPISQAVLAMVC
QKLPSPLDITAERVEKLMCAGSQTFDSLPPETQALKAAFMKCGSEDTAPVIIFVSKMFAV
DAKALPQNKPRPLTQEEIAERRERARRRHAEKLAAAQGQAPVEPTQDAGALEMSPQGEEP
KGDEQGVESETPKPVSPEGSEQESFIAFARVFSGVARKGKRIFVLGPKYSPLEFLQQVPL
GFSAPLEDLPPVPHMACCTLENLYLLMGRELEDLEEVPPGNVLGIGGLQDFVLKSATLCT
SPSCPPFIPLNFEATPIVRVAIEPKHPSEMPQLVKGMKLLNQADPCVQVFIQETGEHVLV
TAGEVHLQRCLDDLKERFAKIEISVSEPIIPFRETITKPPKVDMVNEEIGKQQKVAVIHQ
TKEDQSKIPEGIQVDSNGLITMMTPNKLATLSVRALPLPEEVTQILEESSDLIRSMEQLT
SSLNEGKNNPQMIHQKTQEKIWEFKGKLEHHLTGRKWRNTVDQIWSFGPRKCGPNILVNK
SEDFHNSVWTGLDGKASKEASRYRDLGNSIVSGFQLATLSGPMCEEPLMGVCFVLEKWDL
SKFEEQTASNKQNQEPGDLVKERQGEGDTRSGGDEQQELQDYGSEPFEKRASQRGESPLT
DCYGPFSGQLIATMKEACRYALQVKPQRLMAAMYTCDIMATSDVLGRVYAVLSKREGRVL
QEEMKEGTDMFIIKAVLPVAESFGFADEIRKRTSGLASPQLVFSHWEIIPSDPFWVPTTE
EEYLHFGEKADSENQARKYMNAVRKRKGLYVEEKIVEHAEKQRTLSKNK
Download sequence
Identical sequences E1BH79
ENSBTAP00000044276 XP_002696652.1.76553 XP_005221953.1.76553 XP_005221954.1.76553 XP_015323969.1.59421 XP_015323970.1.59421 XP_015323971.1.59421 ENSBTAP00000044276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]