SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044476 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044476
Domain Number 1 Region: 31-214
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.81e-54
Family Dual specificity phosphatase-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044476   Gene: ENSBTAG00000033255   Transcript: ENSBTAT00000047256
Sequence length 331
Comment pep:known chromosome:UMD3.1:11:10836512:10852450:1 gene:ENSBTAG00000033255 transcript:ENSBTAT00000047256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWHHVGGHWGQDRVFSGYSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLKKS
FEKHLAPEECFSPLDLFNKIQEQNEELGLIIDLTYTRRYYKPEELPENFPYLKIYTVGHQ
VPDDDTIFKFKNAVNGFLRENKDNDRLIGVHCTHGVNRTGYLICRYLIDVEGMRPDDAIE
LFSRCRGHCLERQNYIDDLRNGPIRKNWDSSVSRTRGFEDSTHMMEPVFTATKPVNRRPK
HNIHQTQGYPEPRHFHTWTQDLQQSERKFSRNWNIYQRCHVPPPGPPGEDYFQRRYSWNV
KPSAGQGGPNKRFSPGSYYRVPYSAYYRWTK
Download sequence
Identical sequences E1BCH4
ENSBTAP00000044476 ENSBTAP00000044476 XP_019825467.1.53367 9913.ENSBTAP00000004846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]