SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045009 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045009
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily SAP domain 2.84e-20
Family SAP domain 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045009   Gene: ENSBTAG00000005564   Transcript: ENSBTAT00000047844
Sequence length 651
Comment pep:known chromosome:UMD3.1:10:14878655:15004134:1 gene:ENSBTAG00000005564 transcript:ENSBTAT00000047844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKSKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHGHTVANRSSSDTAAIFGIIPDIISLD
Download sequence
Identical sequences Q24JZ9
9913.ENSBTAP00000045009 ENSBTAP00000045009 NP_001068864.1.59421 NP_001068864.1.76553 XP_019823740.1.53367 ENSBTAP00000045009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]