SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045317 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045317
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 1.21e-48
Family Globins 0.000000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045317   Gene: ENSBTAG00000034024   Transcript: ENSBTAT00000048243
Sequence length 142
Comment pep:known chromosome:UMD3.1:25:192905:194061:1 gene:ENSBTAG00000034024 transcript:ENSBTAT00000048243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTRAERTIIVSMWSKISTQADLIGTETLERLFSCYPQAKTYFPHFDLHTGSAQLRAHG
SRVVAAVGDAVKSIDNVTSALSKLSELHAYVLRVDPVNFKFLSHCLLVTLASHFPADFTA
DVHAAWDKFLSIVSGVLTEKYR
Download sequence
Identical sequences E1BAP8
ENSBTAP00000045317 9913.ENSBTAP00000045317 XP_001788743.1.59421 XP_002683856.1.76553 ENSBTAP00000045317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]