SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045487 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045487
Domain Number 1 Region: 41-276
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.76e-49
Family Glycerophosphoryl diester phosphodiesterase 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045487   Gene: ENSBTAG00000007176   Transcript: ENSBTAT00000048450
Sequence length 291
Comment pep:known chromosome:UMD3.1:19:10410438:10461278:1 gene:ENSBTAG00000007176 transcript:ENSBTAT00000048450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTAAFYLLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLIKHISHRGGAGENLENTMAAF
QHAVTIGTDMLELDCHITKDEQVVVSHDENLKRSTGINVNISDLKYCELPPYLGKLDVSF
QKACQCEGKDNRIPLLKEVFEAFPNTPINIDIKVNNNLLIKKVSELVKQYRREHITVWGN
ASYEIVEKCYKENSEIPILFSLQRVLLVLGLFFTGLLPFVPIREQFFEIPMPSIILKLKE
PHTMSRSQKFLIWLSDILLMRKALFDHLTARGIQVLEKDVLRSIRRKHEKT
Download sequence
Identical sequences F1N2J0
ENSBTAP00000045487 ENSBTAP00000045487 9913.ENSBTAP00000045487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]