SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045488 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045488
Domain Number 1 Region: 131-216
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-16
Family I set domains 0.00011
Further Details:      
 
Domain Number 2 Region: 47-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000619
Family I set domains 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045488   Gene: ENSBTAG00000021842   Transcript: ENSBTAT00000048452
Sequence length 220
Comment pep:known chromosome:UMD3.1:3:7928558:7944601:-1 gene:ENSBTAG00000021842 transcript:ENSBTAT00000048452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIPSFLAFPAARRNRAHCTPWHPWGHMLLWTALLFLAPVSGKPADLPKAVVTIQPAWIN
VLREDHVTLTCQGTSFSAGNLTTWFHNGSSIHTQKQPSYSFRAGSNDSGSYRCQREQTSL
SDPVHLDVISDWLLLQTPSLVFQEGEPIMLRCHSWRNQPLNKITFYQDRKSKIFSYQRTN
FSIPRANLSHSGQYHCTAFIGKMLHSSQPVNITVQGRHWG
Download sequence
Identical sequences E1B9L0
ENSBTAP00000045488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]