SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045669 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045669
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily EF-hand 2.04e-37
Family EF-hand modules in multidomain proteins 0.0045
Further Details:      
 
Domain Number 2 Region: 143-236
Classification Level Classification E-value
Superfamily EF-hand 3.93e-31
Family EF-hand modules in multidomain proteins 0.0052
Further Details:      
 
Domain Number 3 Region: 219-297
Classification Level Classification E-value
Superfamily RING/U-box 3.41e-21
Family ZZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045669   Gene: ENSBTAG00000012307   Transcript: ENSBTAT00000048673
Sequence length 371
Comment pep:known chromosome:UMD3.1:24:22521988:22766995:-1 gene:ENSBTAG00000012307 transcript:ENSBTAT00000048673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIE
ALRENALNNVDPNMELNVARLEAVLSTIFYQLNKRMPTTHQIQVEQSISLLLNFLLAAFD
PEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTA
VFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHP
VECSYCHSESMLGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLT
NALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFIT
RSSDGAYGGYV
Download sequence
Identical sequences Q17QL2
ENSBTAP00000045669 XP_005224095.1.76553 XP_005697056.1.57651 XP_005889310.1.15283 XP_005960601.1.78601 XP_006059196.1.26621 XP_010848078.1.44457 XP_011958779.1.66739 XP_012009723.1.54773 XP_019842153.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]