SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045862 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045862
Domain Number 1 Region: 271-529
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.31e-49
Family Glycerophosphoryl diester phosphodiesterase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045862   Gene: ENSBTAG00000034536   Transcript: ENSBTAT00000048899
Sequence length 565
Comment pep:novel chromosome:UMD3.1:29:19084486:19188797:1 gene:ENSBTAG00000034536 transcript:ENSBTAT00000048899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTETGNEETGRWKNFNSWIKYYFNYECYMTFLNGCYSCKWEAQQKKKAKRPLCCCSLRER
LFYPWLIMSFCLSVLLFFTWIETSNEFNGFDWVVFLGTGVWFFWSIVLLSFLGILAAYTT
LLLVLGFLLCWEKQRLYLHWYHKILVLIMIPFFSLLLWILLTYWKDRWLTIGLSLQILAP
YVHLSSISVMVLLSWPVAFYLIHLEGEARMRRYQITSNERRRNTCCSMLTKSFSALQVAV
GVPFFFILLCLYVVPFGTYSPCLQEKEKLAPKPNFFGHRGAPMLGPENTIMSFEKAVEYG
AHGLESDVQISFDGVPFLMHDYDLRRTTNIKEVLPDAARRHPSLFRWSFLTTLNAGKWFS
AHVKPFFRMKPLSEDDKERARNQRIAKLTDLLAIAQKEKKLVIFDLNAPPSRHPSRLSYI
HLVVRVILDSKIEQHLIAWLPGSERRYIKSKAPGFQHVGTFYTLQELADENITRINVDYK
RLYYNGLREYKAANISINLYIVNEPWLFSLVWCHSIHSVTTDNIEVLNEMNHPYYFMTPS
FYLFLWIFMDILSAVFIVSIFRFHW
Download sequence
Identical sequences F1N4D7
ENSBTAP00000045855 ENSBTAP00000045862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]