SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046176 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046176
Domain Number 1 Region: 11-266
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-81
Family Eukaryotic proteases 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046176   Gene: ENSBTAG00000034665   Transcript: ENSBTAT00000049259
Sequence length 321
Comment pep:novel chromosome:UMD3.1:8:8573278:8591243:-1 gene:ENSBTAG00000034665 transcript:ENSBTAT00000049259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLWSLLLLMSQARDAHLECGERPMFARGAQYSRITGGIEAGVGEFPWQVSIQARNEHFC
GGAILNEWWIITAAHCFYPEQLPPTDLRVVLGTNSLTSPSLEIKGVTTIIRHKDFQRVSM
DNDIALLMLDNPITFNELKEPICLPMQPGLSQWHKCWVAGWGQVKSGLNQPMETELLKAP
MTIMNWDKCFKEFPKLTKNMLCAGYENESYDSCQGDSGGPLACTQESGKKWYHVGIISWG
RSCGLKNTPGIYTLLENYHSWIKKVTELEGRPFRAEQMVGTSKQKAKVSRASEFPKPGSP
TLWLLLCLLPYVTLRSISNSK
Download sequence
Identical sequences E1BLW6
9913.ENSBTAP00000046176 ENSBTAP00000046176 ENSBTAP00000046176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]