SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046266 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000046266
Domain Number - Region: 55-135
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000293
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046266   Gene: ENSBTAG00000014141   Transcript: ENSBTAT00000049366
Sequence length 352
Comment pep:known chromosome:UMD3.1:27:6675063:6683885:-1 gene:ENSBTAG00000014141 transcript:ENSBTAT00000049366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGPRGGLLTQPAAARPKTRSVLPCQAAPNGQKPKKCLVYPHPPKSSRLSRSVLRWLQ
SLDLTFFPRNISRDFSNGFLIAEIFTTYYPWDLKLSSFKNGTSLKVKLDNWAQLEKFLAR
KKLKLPKELIHGTIHCKAGVPEILIQEVYTLLTHREIKSIQEDLVNFTDYSYQMQLPLVP
RSTASKSIKDNIRLSELIGNPNKLNNELKVEFLFLLQMLQRKLSRKLNPKWFAVKPTVGE
STLDHRPAKASGNKSNSVVSKERPVPVCCAASVSTSRAKKQSKQGKPPSQGAPTFFYMSH
PNTDFCLKKKLSRLRGNRVSTPKEIEVKQTRTYSDCMKPTINVEKEPEEAPV
Download sequence
Identical sequences Q3SZH4
ENSBTAP00000046266 ENSBTAP00000018797 XP_005226001.1.76553 9913.ENSBTAP00000046266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]