SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046494 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046494
Domain Number 1 Region: 1-288
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.3e-40
Family Bacterial PLC 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046494   Gene: ENSBTAG00000035122   Transcript: ENSBTAT00000049627
Sequence length 291
Comment pep:novel chromosome:UMD3.1:X:143653392:143661750:1 gene:ENSBTAG00000035122 transcript:ENSBTAT00000049627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMPLHHLSIPGSHSMMTYCLNKKSPISHKESRLLQTLGKVLPCVTLPVVLKRSTTQECAE
HREAPAHRGCWREDLQMAHMEEGTERNLHSGHMVYMTALTEDMLTEISEWLENHPQEVVI
LACRNFKGVMEDLHEYLMGCIKNIFGDMLCPMGEMLTLHQLWSQGQQVILSYKDEASVSQ
HAELWPGIPYWWGNQVKPRDLVHHLELMKSCSHPGRLMVAGINLSENLEFVRVHPAWSLE
KLTQWGLPYLCAWVRGQCPGSATGRTNTVAGEFIWADGFVGDVIGLNWKLL
Download sequence
Identical sequences F1MM65
ENSBTAP00000046494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]