SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046639 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046639
Domain Number 1 Region: 386-525
Classification Level Classification E-value
Superfamily EF-hand 2.07e-20
Family Calmodulin-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046639   Gene: ENSBTAG00000014859   Transcript: ENSBTAT00000049807
Sequence length 548
Comment pep:known_by_projection chromosome:UMD3.1:5:4769057:4806601:-1 gene:ENSBTAG00000014859 transcript:ENSBTAT00000049807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVPQLDLGSLVDSDEEDDLPYMPLSTEHIHFNPTNSSFGFGWVTPCHKLYTQHHLYDLFL
EQDRIPENLPAPTDKYKLKHQQYKTEMTGGYKQYSQRNAEKAKSTNFPDSNRFVENGFYY
DLTTLDRKALLQLGYAANPHILQRSTGKSDADVVAAEKKKQMVAEQVMIDHLSRAVISDP
EQNLTSEKPEISHILPDSKLAPIRFRKRTLHETKIRTQSTLTENILSHKVQFDGRIISRN
GRDACRELVGFFFTHDQSLTIYEYRQFGKNRTNVLPFIQKNIYCHQRGRRKGKQYRLADL
YVGANLTFLSSDHPRLPESVKENTVLTLRITNVDWRALDSLKTDSEEHDDVTSEEANDRK
ILKAIQDLLKEQLRRRGVRILTGLGKHLQQLDKEGNGLLDKADFKQALKLFRLEVSENDF
ESFWLILNSSGNGRADYGEFKRAIIGEMNEYRKSFVRKAFMKLDFNKTGSVSIIDIRKCY
CAKMHPRVISGHSTEEEIKSSFLETLKDACSKSDEVSYGEFEDYYEGLSIGIVDDEDFVN
VLCTPWGI
Download sequence
Identical sequences F1MD06
ENSBTAP00000046639 9913.ENSBTAP00000046639 ENSBTAP00000046639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]