SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046933 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046933
Domain Number 1 Region: 119-491
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.16e-142
Family Myotubularin-like phosphatases 0.0000000268
Further Details:      
 
Domain Number 2 Region: 5-111
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000227
Family VPS36 N-terminal domain-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046933   Gene: ENSBTAG00000035705   Transcript: ENSBTAT00000050192
Sequence length 493
Comment pep:known_by_projection chromosome:UMD3.1:X:101228033:101491280:1 gene:ENSBTAG00000035705 transcript:ENSBTAT00000050192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSNKVENVKLLDRYVGKKPANGSLYLTATHLIYVEASGTARKETWIALHHIATVEKLPV
TSLGCPLILRCKNFRVAHFVLESDIVCHEVYISLLKLSQPELPEDLYAFSYNPKFSKDMR
ESGWKLIDQTSDFGRMGIPNRYWTITDANRNYEICSTYPLEIVIPKSVTLGTVVGSSKFR
SKERVPVLSYLYKENNAAICRCSQPLSGFYTRCIDDELLLEAIRQTNPGSQFLYVVDTRP
KLNALANRAAGKGYENEDNYANIRFRFMSIENIHVMRSSLQKLLEVCELKTPTMSEFLSG
LESSGWLRHIKAIMDAGIFIAKAVKVEKTNVLVHCSDGWDRTAQVCSVASILLDPFYRTF
KGLMKIKILIEKEWISMGHKFSQRCGHLDGDSKEVSPIFTQFLDCIWQLMEQFPCAFEFN
ENFLLEIHDHVFSCQFGNFLGNCQKDRDDLRIYEKTHSVWPFLVQRKPDFRNPLYKGFTM
YGVLNPSTVPYNI
Download sequence
Identical sequences F1ME94
ENSBTAP00000046933 ENSBTAP00000046933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]