SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046935 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046935
Domain Number 1 Region: 1-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.83e-55
Family Eukaryotic proteases 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046935   Gene: ENSBTAG00000037971   Transcript: ENSBTAT00000050194
Sequence length 277
Comment pep:novel chromosome:UMD3.1:8:66102895:66114341:-1 gene:ENSBTAG00000037971 transcript:ENSBTAT00000050194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGISKVMGRIYGGRDVEAGRRLWQASLWSQGSHICGAVLINSSWLLSTAHCFLKKGKEIQ
SPVELRGLLGSTQLSQHTREVSVSQIITHPDFKKLHPFGSDIAMLQLLYPVNFTSYIIPA
CLLIPGMKLPSNSSYWIPGWGMLNEETSFPDFLLMLVAPLLEPFHLQEDGRGKNWAVHME
MLRAGDFSTGKSSCRSDSEGPLICDFTSWVLMGLASWGFDCRHPIYPSIFTNVTNWMDEI
QRLTPLPEPTSALPAESRKPHNALVPAFRIPDNLVKF
Download sequence
Identical sequences G3X821
ENSBTAP00000046935 ENSBTAP00000046935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]