SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046936 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046936
Domain Number 1 Region: 77-331
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.28e-78
Family Eukaryotic proteases 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046936   Gene: ENSBTAG00000035708   Transcript: ENSBTAT00000050195
Sequence length 397
Comment pep:known chromosome:UMD3.1:8:65834278:65865690:-1 gene:ENSBTAG00000035708 transcript:ENSBTAT00000050195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLGSVTLAMGGEAGIPQGLGQSEALLWLLLLNVATLELRGSPATAAPGRTAGDGGALRGG
APTWPAQRLAPGATGGSRVSTVCGKPKVMGRIYGGRDVEAGQWPWQASLRFQGSHICGAV
LINSSWLLSTAHCFLKKSKAPENYQVLLGSIQLYQHTPQTREVSVSRIITHPDFEKLHPF
GSDIAMLQLLFPVNFTSYIIPACLPVPGMKLPSNSSCWITGWGMLNEETPLLEPFHLQEG
KVSFVENKFCNMLYGLAKGKNVSVQEDMLCAGDFSTGTSICLGDSGGPLVCDFTSSWVLM
GLASWGFDCRHPIYPSIFTNVTYFTNWIEEIQRLTPNPEPTSALTPLPEPTSTPPQTQFP
HQSLRAAASSVLGTAFVPPQTWPLLLFLLGSLRQATW
Download sequence
Identical sequences F1ME93
ENSBTAP00000046936 ENSBTAP00000046936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]