SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046984 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000046984
Domain Number - Region: 111-157
Classification Level Classification E-value
Superfamily EF-hand 0.00128
Family Calmodulin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046984   Gene: ENSBTAG00000036222   Transcript: ENSBTAT00000050251
Sequence length 1243
Comment pep:novel chromosome:UMD3.1:13:17742124:17783203:1 gene:ENSBTAG00000036222 transcript:ENSBTAT00000050251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASRAVPPKCVSSSKWYGRQSQPKPCGAAGGAPGLLEQPAIPSARSQLRGSASLESVESLK
SDEEANSAKEPQNELFEAQGQLPTWGSEVFGSPKPCSHSFDTPESQVWGLWEELGVGISG
HLPEQELALVCQSIGLQGLVKEEPEDLFNKLDQDGDGRVLEELQLGLFNHGSPRPLELAP
LVKPSRSWSRYQVPEESVGQTTTSSLVSVCSGPRLFCSVDDGSGFAFLEQIISFGAQEGV
HNGREVLQSLDFSVDEKVNLLELTWALENELMMVGGAAQQAALACYRQDLSFCQEQVEQM
VRERDKARQDLEKAEQRNLEFVKETDDLHSAREQLTEEKVRHLEQSYRGRLSLLRSEVEV
ERELFWEEARRQRAGLEEDLRKRLQAKETGLHEKLTLALKEMTEVVEKLSDSEKLVLKLQ
NDLEFVLRDKLEPQSTELLAQEERFSEILKEYELKYRDLQDHSDKLQAALESLQAQAAPS
RHGRLPPGHGRGTVTFVGDSAPASIETEIMLEQVKEHYQDPAGDQGLSPQVNDHEREMEE
TKRAFAEERRELERAFQLEVGVLQGQKAKLVMLQAESQEVVQGLRQQLQRQVLGPRPLEG
LCQEPPSTTQEMTWVTAGRHSSRRVLQRQRLRELLCPLSGQRTLAHRTRRCVQLRHPPPV
PPRRLDCLSPSRPCCRPLPQTRGSPMVWSLGRAEVVLGLTSGRASGERVDPLLQLRLRSK
AGLGPSAPGVHIRPLAHSGPSVREQPSGHMPSLPSVSGTSSGLAQEPVLSSSSTQPPGPG
AVLGLSPLLLTRGTPWLVGPTANVTVPVSVVSGSLDRVSWAPATCCHRGHGRFSNLQTGR
CTEWSSAWMPALPGNQPSTRTPGVVSPHRYSCSSVAHHWSYLPGRLRASEAKGSRQTWPG
QPLEGIPLQQLCEDSHPASCIGASYEHADISVKNLLSRIELEKLSEENTLLKNELGRIRQ
EFEASERTEAAQRKEIEVLKRDKEKACSEMEELCTQSQKCRDELSQLNHRVLQLGEEAST
HQTQSEKSPVTVQLLTHGLEEAELREELQGNQIQKLELDRVTQDHQSLRLAQSQLREALE
ESGPGLYGATQRLQLARLQHAQQVRQLREEMAQLVPAVRVAELQRLLEGERRGAWWLQAE
AQEAHEKQLKATEEWVEEVETILKNMEVLLQEKVGELKEQFEKNTRSDLLLKELYVENAH
LTKALQVTEEKQRGAEKKSQFLEEKLRALNKLLSKIATASLAV
Download sequence
Identical sequences G5E621
ENSBTAP00000046984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]