SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047378 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047378
Domain Number 1 Region: 9-76,196-264
Classification Level Classification E-value
Superfamily EF-hand 1.12e-17
Family Calbindin D9K 0.037
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000047378
Domain Number - Region: 1075-1264
Classification Level Classification E-value
Superfamily Colicin Ia, N-terminal domain 0.0131
Family Colicin Ia, N-terminal domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047378   Gene: ENSBTAG00000023169   Transcript: ENSBTAT00000050711
Sequence length 1398
Comment pep:novel chromosome:UMD3.1:13:10934396:10992906:1 gene:ENSBTAG00000023169 transcript:ENSBTAT00000050711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKEEENHYVSQLRDVYSSCDTTGTGFLDREELTQLCLKLHLEKQLPVLLHTLLGNNQFA
RVNFEEFKDGFIAVLSSQSGLASSDEDSGSLESVASRAVPPKYVSGSKWYGRRSHPEPCG
AAGGAPGLLEQPARPSARSKLRRSASLESVESLKSDEEADSAKEPQNELFEAQGQLPTWG
SEVFGSARKPRSHSFDTPETRVWGLWEELGVGSSGHLTEQELALVCQSIGLQGLAKEELE
DLFNKLDQDGDGRVSLEELQLGLFNHGSPRPLELAPLVKPSRSWSRYQVPEESVGQTPTS
SLVSVCSGPRLFCSVDDGSGFAFPEQIISLWAQEGVHNGREVLQSLDFSVDEKVNLLELT
WALENELMMVGGATQQAALACYRQELSFCQDQVEQMARERDKARQDLEKAEQRNLEFVKE
TDDLHSALEQLTEEKVRRLEQGYQGRLSLLRSEVEVERELFWEEARRQRAGLEEDLRRLQ
AEETGLHEKLTLALKENSRLQKEMIEVVEKLSDSQKLVLKLQNDLEFVLKDKLEPQSTEL
LAQEERFSEIQKEYELKCRDLQDRNDELQAALEGLQAQAALSRHGRLPPGQSPAGTITFV
GDSAPASIKTEIMLELLKEHYQELKIQLQTKVNDHEREMEETKRAFAEERRELEQAFQLE
VGVLQGQKAELATLHAESQEVVRGLQDQLQRRAELERGHTWWLSQERARPQEALQRLRSA
TPALRDLRSKEPRPLEGLCQEPPSTTQEMTWVTAGRPSCVLWLRLSTQCLLVPLPQAHRV
LQRQSLCELLCPLSGQRTLAHCTRRCVQLRRFPGHLPPAVTAEGAARSETGVCSFRPQVG
GRTKQGSILQHLLQASMELLSHRAEVPFSFYLQATPGNQPSTRTPGVVSPHRSRIRQPPS
YSRSRKLETEPHPPLPPTYTHTPVSNQFCLPSRSLNNSSKYRSHWRSLSSLKPFISFPHE
KNVIILMLMKEMLMLDIISQLLICCTSLELPSRETKSIGSQGLQADLAWAASGVGQGALP
IGFSFLSPHVPQLCARGPWGDFLATTHPASCIGASCEHGDISVKLISWEMQARAGRDWCP
VSPSREDLLSRIELEKLSEENTLLKNELGRIQQELEASERTEAAQRKDIEVLKRDKEKAC
SEMEELRTQSQKCRDELSQLNHRVLQLGEEASTHQTQSEKSPVTVQLLTHRLEEAELREE
LQGNQIQKLELELDRVTRDRQSLRLAQSQLREALEESRNQLYGATQRLQLAQSQHTQRVQ
QLREEMAQLVPAVRVAELQRLLEGERLGARRLQEEAQEAHERQLKATEERVEEVEMILKN
MEVLLQEKVGELKEQFEKNSRSDLLLKELYVENAHLTKALQVTEEKQRGAEKKSRFLEEK
VRALSKLLSKIATASLAV
Download sequence
Identical sequences G5E648
ENSBTAP00000047378 ENSBTAP00000047378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]