SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047507 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047507
Domain Number 1 Region: 343-454
Classification Level Classification E-value
Superfamily SRCR-like 3.14e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 96-197
Classification Level Classification E-value
Superfamily SRCR-like 1.12e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0058
Further Details:      
 
Domain Number 3 Region: 224-334
Classification Level Classification E-value
Superfamily SRCR-like 6.41e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1-91
Classification Level Classification E-value
Superfamily SRCR-like 1.18e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047507   Gene: ENSBTAG00000030371   Transcript: ENSBTAT00000056251
Sequence length 620
Comment pep:novel chromosome:UMD3.1:5:102968842:102991326:-1 gene:ENSBTAG00000030371 transcript:ENSBTAT00000056251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEVHSGEEWTPVSDGNFALSTAHVICAELGCGTAGFVLGHVPFRESDGRVWAEEFRCKGE
EPKLQFCPRVPCPGATCHHSGAVQVVCSAYSEVQLMTNGTSQCEGQVKMNTSGRWRALCA
SHWSLANANVVCHQLGCGVAISTPRGPHFVEGSDQISTVRFHCLGAESFLWSCPVTVLGG
LDCSHDNTASVICSGNQTEVLPQCDDSVSEPAGSAASEESTPYCSEFLALKMVSKDQQCA
GWLEVFYSGTWGSVCHSPMEDITVSMICRQLGCGESGILNSSVALREGSRPQWVDGVQCR
KTDTSLWQCPSDPWNYTSCYPKEEVYISCAGGRHQICPTAAFCTDREKLRLRGGDSKCSG
QVEVWHSGSWGTVCDDSWSLAEAEVVCQQLGCGQALEAVWATGFGPGNGNIWLDEVWCRG
QESSLWDCAAELWGQSDCKHEEDAGVRCSAVRITLPAPQLPPNPLPGAFSLPEVLCFILG
VLLFLVLVILVTQLLRWKAECRALSSYEDALAEAVYEDLDHLVTQKEDLLGSPAPDQRTD
ALGEDYDDAEEVPLPGAPSASQGSEEEVPPEKVDVTRSSQTGSSLNISREVADPREEEES
PWLLQGEEADTGYDDVELSA
Download sequence
Identical sequences E1BD62
ENSBTAP00000047507 ENSBTAP00000047507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]