SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047553 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047553
Domain Number 1 Region: 213-387,429-475
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.15e-27
Family Prokaryotic proteases 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047553   Gene: ENSBTAG00000036016   Transcript: ENSBTAT00000054469
Sequence length 512
Comment pep:known_by_projection chromosome:UMD3.1:15:83580546:83582417:1 gene:ENSBTAG00000036016 transcript:ENSBTAT00000054469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NIYSVLSADDHFSERMKKHVNKNIIVYEEETIKAYINLGMPLRCLPSGSHLKITFGQRSN
EKDDQVLRPCKNPDTECILFHVVAIGKTRKMIVKINELHVQGTTLCVYALKGETIKEALC
NDGRFLSNLDTLEWTLRDHKNIYGKQSIVDIVSGKVLELEILKKLSIKKCTHIKIKPEDN
LQILNKVMMHQYPNFNKEALRIQKYFQEERERMKLTTSKQFSMYKHYFGKVTENSVSVAI
CERLVHLSKSVGFMKWDNNGNTGNATCFVFNDGFIFTCRHVLHLIVGEGTDRKSWPDIIS
TCVKVTFTYKEFCPNDVDWLSFEPWFMVSGETLDYAILKLSENGNGFPPGLSKLIFRQPS
DGLLYLIGHPEGQIKKIDGCSVISLEQRLERYKEHYSDGVVPGSCSDIYNAFPMFTQRSF
LSEVWSTNTLSYDTYFSSGSSGSPVFNASGKLVAMHSFGHFYSHVNKAYALIEFGYSMES
ILCDIKQKEEKNESHNEEKDNKQELSLQESQI
Download sequence
Identical sequences F1N0B6
ENSBTAP00000047553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]