SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047875 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047875
Domain Number 1 Region: 349-532
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000000204
Family Prokaryotic proteases 0.05
Further Details:      
 
Domain Number 2 Region: 25-54,183-287
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000195
Family Prokaryotic proteases 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047875   Gene: ENSBTAG00000038845   Transcript: ENSBTAT00000052816
Sequence length 565
Comment pep:known_by_projection chromosome:UMD3.1:28:26531082:26537924:-1 gene:ENSBTAG00000038845 transcript:ENSBTAT00000052816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRQWGPAMRAAEQAGCVVSASRAGQPEAGSWSCSGVILNRRPGLVLCHGGIFTPFLRAG
SGALTAASTAFLPGDSCGDDLRLHVQCGPTAASPAGRAERGRPGLCTPQCAGLEPGPPAR
PRGRPLQPPRPAELLLLLSCPAFRGHFVRLFGGEEAEQWRFANAAPDDEVSEEEEEDQLR
ALGWFALLRVRPEMEKEAEERGPVLAVAPLGDVPKGAPLLACGSPFGAFCPDIFLNTLSR
GVLSNSAGPLLLTDARCLPGTEGGGVFASRPAGALVALVAAPLCWKAREWVGLTLLCAAA
PLLSVARAALCRLHPDTAALAALLPPEMGAPWGLPLRYRDPGPPWAAAAVLVECGSVWGS
GVAVAPHLVVTCRHVAPRETARVLVHSTTPKSAIIWGRVVFATQETSPYDIAVVRLEEDL
DGVPVPVPAEHFHEASFPTLAGVTSQAGTSLHPGYSALAGVALRGLPAVLSMPTVLGGRS
WGPGESSHGGNRTGIVASNTRDNNTGATYPHLNFSIPITVLQPALQQYSQTGDLGGFRQL
DRASEPVRVVWRLQRPPAEALRSKL
Download sequence
Identical sequences E1BF31
ENSBTAP00000047875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]