SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047882 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047882
Domain Number 1 Region: 64-143
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000257
Family Calmodulin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047882   Gene: ENSBTAG00000003358   Transcript: ENSBTAT00000026596
Sequence length 145
Comment pep:known chromosome:UMD3.1:11:29200743:29210371:-1 gene:ENSBTAG00000003358 transcript:ENSBTAT00000026596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLRLLRIPFLCGLLWAFCAPGARAEEPGASSSHHGSMGLDKNTVHDQEHIMEHLEGVI
NKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPMNEDELINLI
DGVLRDDDKNNDGYIDYAEFAKSLQ
Download sequence
Identical sequences F6PZ29
ENSBTAP00000047882 NP_001035685.2.59421 NP_001035685.2.76553 XP_005895680.1.15283 XP_006054864.1.26621 XP_006054866.1.26621 XP_010836946.1.44457 XP_014333657.1.15283 XP_014333658.1.15283 XP_019825666.1.53367 ENSBTAP00000047882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]