SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047958 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047958
Domain Number 1 Region: 399-681
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.68e-89
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000113
Further Details:      
 
Domain Number 2 Region: 223-396
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.27e-46
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00025
Further Details:      
 
Domain Number 3 Region: 161-221
Classification Level Classification E-value
Superfamily TGS-like 0.000000000000436
Family TGS domain 0.006
Further Details:      
 
Domain Number 4 Region: 683-717
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.000000589
Family Anticodon-binding domain of Class II aaRS 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047958   Gene: ENSBTAG00000007651   Transcript: ENSBTAT00000052449
Sequence length 724
Comment pep:known chromosome:UMD3.1:21:29296001:29340066:1 gene:ENSBTAG00000007651 transcript:ENSBTAT00000052449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEALAAEAVASRLARQEEDIRWLWAEVHRLRDEQLNAPDRCQAEGPCLTREVAQLRAE
NRELRHCLYRLRLCLAEELSHQARLESAARAEAGRAAAGAQPPPSQSLEEDVKKEIDPDN
EVKNPPNFMKERLKFFEILKKDHQLLLAIYEKKGDSSNVITVRVADGRTVKGEAWKTTPY
QVAAEISQELAETTVVAKVNGELWDLDRPLEGDATVELLTFEDEEARAVYWHSSAHVLGE
ALELHYGGLLCCSPPGDGSFHYDVYLEDRAVSSAELPVLESMCQAIIKEQQPFERLEVST
KVLLDLFKYNKFKCRILKEKVATPTTTVYRCGPLVELCKGPHVRHTGTIKVIKIFKNSLA
YWADNPEMEMLQRVYGVSFPDEQRMAAWEELQEEARARDHRTIGKEQELFFFHDLSPGSC
FFLPRGACIYNTLIDFIREQHHQRNFTEVLSPNMYSCKLWEASGHWQHYSENMFTFDIDK
DTFALKPMNCPGHCLMFAHRPRSWREMPIRLADFGVLHRNEPSGALSGLTCVRRFQQDDA
HIFCTVGQLEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGKIELWDEAEKQLQNSL
MEFGKPWKINPGEGAFYGPKIDLEIKDALGRYHQCATIQLDFQLPIRFNLTYVSKDGDDK
KNPVIIHQAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQWLEKRKR
QIML
Download sequence
Identical sequences A6QNM8
ENSBTAP00000047958 NP_001095559.1.59421 NP_001095559.1.76553 ENSBTAP00000047958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]