SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048088 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048088
Domain Number 1 Region: 9-249
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.14e-63
Family Eukaryotic proteases 0.000000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048088   Gene: ENSBTAG00000038159   Transcript: ENSBTAT00000057123
Sequence length 251
Comment pep:known chromosome:UMD3.1:21:35140512:35152721:1 gene:ENSBTAG00000038159 transcript:ENSBTAT00000057123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLLLLMAFFLPPGLGLAGIFLSGKIIGGHEAKPHSRPYMVFLQFKISGEPQRCGGFLV
REDFVLTAAHCLGSSINVTLGAHNIMDRERTQQFIPVRRPIPYPRYNKTWANDIMLLQLE
RKAKQMSAVKPLSLPKAKAQMKPGQVCSLAGWGQVALGTPATTLQEAELMVQEDRMCESL
NPRHYSRATQNCVGDPRKVKTGFKGDSGGPLVCKKVVHGTFSYGKKNGTPLGVFIQVSHF
LPWIKRTMKHL
Download sequence
Identical sequences F1MGA4
ENSBTAP00000048088 ENSBTAP00000048088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]