SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048279 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048279
Domain Number 1 Region: 82-322
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.05e-83
Family Eukaryotic proteases 0.0000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048279   Gene: ENSBTAG00000004003   Transcript: ENSBTAT00000053637
Sequence length 324
Comment pep:known chromosome:UMD3.1:X:23025837:23059616:1 gene:ENSBTAG00000004003 transcript:ENSBTAT00000053637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADASSFVKGTQITRWFVPVLTDTDLQKTKSPANQQCHFPVDESLSHIFLRSSPVLRLFF
NTNYENSSEAEIIWDNVTQSNQSFDEFSRVVGGEDAERGQFPWQVLLHGEIAAFCGGSIV
NEKWVVTAAHCIKPGVKITVVAGEHNTEKPEPTEQKRNVIRAIPYHSYNASINKYSHDIA
LLELDEPLELNSYVTPICIADRDYTNIFLKFGYGYVSGWGKVFNRGRSASILQYLKVPLV
DRATCLRSTKFSIYSHMFCAGYHEGGKDSCQGDSGGPHVTEVEGTSFLTGIISWGEECAM
KGKYGIYTKVSRYVNWIKEKTKLT
Download sequence
Identical sequences F1MBC5
ENSBTAP00000048279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]