SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048496 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048496
Domain Number 1 Region: 13-49,124-321
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000022
Family FAD-linked reductases, N-terminal domain 0.067
Further Details:      
 
Domain Number 2 Region: 232-467
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000734
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048496   Gene: ENSBTAG00000012508   Transcript: ENSBTAT00000055672
Sequence length 478
Comment pep:known chromosome:UMD3.1:18:10294996:10305608:1 gene:ENSBTAG00000012508 transcript:ENSBTAT00000055672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNQRKDHLGASSSEPLRVIIIGNGPSGICLSYLLSGYTPYVRPDAIHPHPLLQRKLSEA
PGVSIMDQDLDYLSEGLEGRCQSPVALLFDALLRPDTDFGGSVESVLTWRHQKERAIPHL
VLGRNPPGGAWHSIEGSMVTLSQGEWMGLPDLQVKDWMCKKRRGLRNSRATAGDIAHYYR
DYVIRKGLSHNFVSSATVTAVEWGTPEPSSPGARDPSPLFQVSGFVTAEDQSQQSFSLRA
HNVVLATGTSDSPARLGIPGEALPFVHHDLSALEAATQAGTVSPSSDPVLIIGAGLSAAD
AVLYARHYSVPVIHAFRRPVDDPGLVFNQLPKMLYPEYHKVHQMMREQSILSPSPYEGYR
SLPEHQLLLLKEDRQAVFRDPQGLQKVFGVALVLVLIGSHPDLSFLPGAGTDLAVDPDQP
LSAKRNPIEVDPFTYQTIHQEGLYAMGPLAGDNFVRFVQGGALAVASSLLRKEARKPP
Download sequence
Identical sequences Q2KIN7
ENSBTAP00000048496 NP_001070597.1.59421 NP_001070597.1.76553 ENSBTAP00000048496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]