SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048539 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048539
Domain Number 1 Region: 343-506
Classification Level Classification E-value
Superfamily EF-hand 2.3e-31
Family Calmodulin-like 0.0031
Further Details:      
 
Domain Number 2 Region: 47-294
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00000000000458
Family Glycerol-3-phosphate (1)-acyltransferase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048539   Gene: ENSBTAG00000040248   Transcript: ENSBTAT00000052156
Sequence length 518
Comment pep:known chromosome:UMD3.1:3:51490101:51491654:-1 gene:ENSBTAG00000040248 transcript:ENSBTAT00000052156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSTSPPLDSEPAVVDPKAALESAFSREMNKSLFPPAVENPFVQHTHISAWRWAYIVLM
GTVLVPVRVSCIAFLFIFLWPVAALSTIGCRAQPTKPAKNWRRLAQPTLKFLFQVTFFLA
GFLVKVKGKKATRDEARIFVAAPHSSFFDAIACVVAGLPSVVSASQNANIPVAGKFLLST
QPVLVTRDDPNSRKTTREEILKRVTSNRQWPQILIFPEGVCTNRSCLVTFKLGAFSPGVP
VQPVLLRYPNPLDTVTWTWQGFTGFQACMLTLSQPFTRVEVEFMPVYIPNVQEKKDPVLF
ANTVRIIMANALGVPVTDHTYEDCRLMISAGNLQLPMEAGLVEFTKISQNLKLDWDNIHQ
CLDKYAEIAVASKGGKIGIEEFANYLKLPISKPLQQLFALFDRNNDGTIDFREYVIGLTV
LCNPVNTEKILQMSFKLFDLDKDGFITEQELAAILRAAFGVPDLDVSTLFREIAGPNSDR
ISYRTFKKFALKHPAYAKLFSSYLDLQAAYVYSLPQPV
Download sequence
Identical sequences F1N7P3
ENSBTAP00000048539 ENSBTAP00000048539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]