SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048799 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048799
Domain Number 1 Region: 13-337
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.2e-50
Family FAD-linked reductases, N-terminal domain 0.0059
Further Details:      
 
Domain Number 2 Region: 317-440
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.49e-29
Family L-aminoacid/polyamine oxidase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048799   Gene: ENSBTAG00000018321   Transcript: ENSBTAT00000057083
Sequence length 529
Comment pep:known_by_projection chromosome:UMD3.1:26:25830772:25837548:-1 gene:ENSBTAG00000018321 transcript:ENSBTAT00000057083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSGGRQAEAPGRGPRVLVVGGGIAGLGAAQRLCRHPAFSHLRVLEATARAGGRIRSEHS
FGGVVEVGAHWIHGPSQGNPVFQLAAKYGLLGEKALSEENQLIETGGHVGLPSVSYASSG
VSVSLELVAEMASLFYSLIDQTREFLLAAETTPPSVGEYLKEKIRQHMAGWTEDEETKKL
KLAILKNLFNVECCVSGTHSMDLVALAPFGEYTVLPGLDCTFPEGYQGLTDCIMASLPKD
VMVFDKPVKTIHWNGSFREASAPGETFPVLVECEDGDYFPAHHVVVTVPLGFFKKHLDTF
FEPPLPTEKVEAIRKIGFGTNNKIFLEFEEPFWEPDCQHIQVVWEDMSPLEDTAPELQDA
WFKKLIGFWVLPPFQASHVLCGFIAGLESEFMETLSDEDVLRSLTQVLRRVTGNPQLPAP
RSMLRSCWHSAPYTRGSYSYVAVGSSGDDMDRLAQPLPSDGKGAQRGFPGGSVVENLPAM
QETRAQSLGQEDPLEKEIATHSSILAWRIPWTEEPDGLQSVGSQRVRHD
Download sequence
Identical sequences F1MQP7
9913.ENSBTAP00000048799 ENSBTAP00000024381 ENSBTAP00000048799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]