SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048972 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048972
Domain Number 1 Region: 17-281
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.55e-82
Family Eukaryotic proteases 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048972   Gene: ENSBTAG00000038568   Transcript: ENSBTAT00000052985
Sequence length 312
Comment pep:novel chromosome:UMD3.1:25:2256600:2268388:1 gene:ENSBTAG00000038568 transcript:ENSBTAT00000052985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPQGAALLLAQLLVRIEIAEQAQPSVRLSIPGPCGIQGIQVRVVGGNEAKLGRWPWQGS
LRWNKVHSCGASLLNRRWALSAAHCFEKNSYPSEWSVQFGELSATPSIWSLRAFLRRYGV
QDIITFSQFRKNFQHDIALVKLSSPVTFNKHVQPVCVTSSSLEFKNRNDCWVTGWGNIGE
RQKLLPPYNLREVQVSIINKSRCSYLFQQPLYRRNINHGMICAGSEDGDADSCKGDSGGP
LVCEKNGRWIQIGIVSWGVGCGRRNRPGVYTNVSHYFSWIQLLTARSTPRPDPSWLLLPL
ALLWTLLLLQMA
Download sequence
Identical sequences E1B7M0
ENSBTAP00000019098 ENSBTAP00000048972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]