SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048999 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048999
Domain Number 1 Region: 66-351
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.32e-95
Family G proteins 0.000000302
Further Details:      
 
Domain Number 2 Region: 334-451
Classification Level Classification E-value
Superfamily Translation proteins 3.3e-25
Family Elongation factors 0.00067
Further Details:      
 
Domain Number 3 Region: 683-770
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.16e-20
Family EF-G/eEF-2 domains III and V 0.0007
Further Details:      
 
Domain Number 4 Region: 485-562
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.48e-20
Family EF-G/eEF-2 domains III and V 0.00022
Further Details:      
 
Domain Number 5 Region: 561-680
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-20
Family Translational machinery components 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048999   Gene: ENSBTAG00000015519   Transcript: ENSBTAT00000054796
Sequence length 777
Comment pep:known chromosome:UMD3.1:20:6669168:6721360:1 gene:ENSBTAG00000015519 transcript:ENSBTAT00000054796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNLRIFAVNQKKISSLHYFNNMCSSKIRASLKRLKLHVLLGRNYSSLPGLIGNDIKSLH
SIINPPIAKIRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDTVTDFMAQERERG
ITIQSAAVTFDWKGYRINLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVW
RQADKHKVPRICFLNKMDKIGASFNYAVESIREKLKAKPLLLQLPIGEGKAFKGVVDVVR
TEKLLWNPNSDDGKDFERKPLLEMSDPKLLKETTEARNALIEQVADLDDEFADLVLGEFS
ENFDLLPAEKLQTAIHRVTLAQTAVPVLCGSALKNKGVQPLLDAITMYLPSPEERNYEFL
QWYKGDLCALAFKVLHDKQRGPLVFMRIYSGMLKPQTAIHNINGNCTERVSRLLLPFADQ
HIEIPLLTAGNIALTVGLKHTATGDTIVSSRSSALAASRRAKREGEKKQKENNEAERLLL
AGVEIPEPVFFCTIEPPSMAKQPDLDHALKCLQREDPSLKVKLDPDSGQTVLCGMGELHI
EIIHDRIKREYGLETYLGPLQVAYREAILNSIRATDTLDRTLGDKRHLVTVELEAKPVET
SSLLPVIEYAASVAGDLSQASREAFENGVHSACLQGPLLGSPVQDVAVTLHSLVIHPGTS
TTMISACVSRCLQKALKKADKQILEPLMNLEVTVSREYLSPVLADLAQRRGNIQEIQSRQ
DNKVVIGYVPLAEIMGYSTVLRTLTSGSATFALELSNYQAMNPQDQSTLLSQRHGLS
Download sequence
Identical sequences A6QNM2
ENSBTAP00000048999 ENSBTAP00000048999 NP_001095579.1.59421 NP_001095579.1.76553 XP_019838409.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]