SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049033 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049033
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 7.05e-52
Family Globins 0.000000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049033   Gene: ENSBTAG00000039056   Transcript: ENSBTAT00000053945
Sequence length 147
Comment pep:novel chromosome:UMD3.1:15:49039183:49040991:1 gene:ENSBTAG00000039056 transcript:ENSBTAT00000053945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFTGEEKAAITDLWGKMNMEEAGGEALGRLLVFYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSFGEAMKNSDNLKGAFAKLSELHCDKLHGDPENFRLLGDVIVIVLATHSG
REFTPDMQAAWQKLVSGVATALAHKYH
Download sequence
Identical sequences E1BIF9
ENSBTAP00000049033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]