SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049136 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049136
Domain Number 1 Region: 19-150
Classification Level Classification E-value
Superfamily Lysozyme-like 1.31e-48
Family C-type lysozyme 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049136   Gene: ENSBTAG00000020564   Transcript: ENSBTAT00000055398
Sequence length 151
Comment pep:known chromosome:UMD3.1:5:44533886:44559481:1 gene:ENSBTAG00000020564 transcript:ENSBTAT00000055398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLILGLLLLSVAVQGKTFKRCELARTLKNLGLAGYKGVSLADWMCLAKGESSYNTQA
KNFNRGSQSTDYGIFQINSKWWCNDGKTPNAVNGCGVSCSALLKDDITQAVACAKKIVSQ
QGLTAWYYFPVAWKNNCRNRDLTSYVQGCGV
Download sequence
Identical sequences E1BG16
ENSBTAP00000049136 ENSBTAP00000049136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]