SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049150 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049150
Domain Number 1 Region: 27-137
Classification Level Classification E-value
Superfamily FKBP-like 2.16e-39
Family FKBP immunophilin/proline isomerase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049150   Gene: ENSBTAG00000008359   Transcript: ENSBTAT00000011007
Sequence length 140
Comment pep:novel chromosome:UMD3.1:1:28611818:28612240:1 gene:ENSBTAG00000008359 transcript:ENSBTAT00000011007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRESWVLTVLSICLSALVMATGAEGKRKLQIGVKKWVDHCPIKSQKGDFLQLHYTGKLED
GTEFDSSLPQNQPFVFSLGTGQVTEGLDQGLLEMCEGEKQKLVIPSELGYGEQGASPKIP
GGATLVFEVELLKIKRHSEL
Download sequence
Identical sequences F1MUA4
ENSBTAP00000049150 ENSBTAP00000049150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]