SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049280 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049280
Domain Number 1 Region: 370-478
Classification Level Classification E-value
Superfamily SRCR-like 9.16e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000614
Further Details:      
 
Domain Number 2 Region: 701-808
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000625
Further Details:      
 
Domain Number 3 Region: 582-688
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000835
Further Details:      
 
Domain Number 4 Region: 25-133
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 5 Region: 237-344
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0037
Further Details:      
 
Domain Number 6 Region: 477-583
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 
Domain Number 7 Region: 134-237
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049280   Gene: ENSBTAG00000026531   Transcript: ENSBTAT00000055996
Sequence length 813
Comment pep:known chromosome:UMD3.1:5:103389271:103439148:-1 gene:ENSBTAG00000026531 transcript:ENSBTAT00000055996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGRHLSLRGLCVLLLGTLVGGQALELRLKDGAHRCEGRVEVKHQGEWGTVYAHGWRLK
DASVVCRQLGCGAAIGFPGGAYFGPGLGPIWLFYTSCEGTESTVSDCEHSNIKDYRNDSY
SHDDDAGVVCSGFVRLAGGDGPCSGRVEVHSGEAWIPVSDGNFTLATAQIICAELGCGKA
VSVLGHELFRESSAQVWAEEFRCEGEEPELSVCPRVPCPGGTCHHSGAAQVVCSAYSEVR
LMTNGSSQCEGQVEMKISGRWRALCASHWSLANANVICRQLGCGVAISTPGGPHLVEEDD
QILTARFHCSGAESFLWSCPVTALGGPDCSHGNTASVICSGNQIQVLPQCNDSLSQPAGS
SASEESAPYCSDSRQLRLVDGGGPCAGRVEILDQGSWGTICDDGWDLDDARVVCRQLGCG
EALNATGSAHFGAGSGPIWLDNLNCTGKESHVWRCPSRGWGQHNCRHKQDAGVICSEFLA
LRMVSEDQQCAGWLEVFYNGTWGSVCRSPMEDITVSMICRQLGCGDSGTLNSSVALREGF
RPQWVDGIQCRKTDTSLWQCPSDPWNYTSCSPKEEAYIWCADSRQIRLVDGGGRCSGRVE
ILDQGSWGTICDDRWDLDDARVVCRQLGCGEALDATISSSFGRGSGPIWLDEVNCRGEES
QVWRCPTWGWQQHNCDHQEDAGVICSGKRGLSCSTESPSSDSRQLRLVDGGGPCAGRVEI
LDQGSWGTICDDGWDLDDARVVCRQLGCGEALNATGSAHFGAGSGPIWLDDLNCTGKESH
VWRCPSRGWGRHDCRHKEDAGVICSGQHSTLST
Download sequence
Identical sequences F1MK68
ENSBTAP00000049280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]