SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049572 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049572
Domain Number 1 Region: 4-145
Classification Level Classification E-value
Superfamily Nudix 4.06e-24
Family MutT-like 0.00000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049572   Gene: ENSBTAG00000005252   Transcript: ENSBTAT00000006914
Sequence length 164
Comment pep:known chromosome:UMD3.1:X:94214374:94219492:-1 gene:ENSBTAG00000005252 transcript:ENSBTAT00000006914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGG
AAVREVFEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVSIGRKREWF
KVEDAIKVLQCHKPVHAEYLQKLKLGGSPTNGNSVAPSPPEGDP
Download sequence
Identical sequences A7MBH2 L8IDW2
ENSBTAP00000049572 ENSBTAP00000049572 NP_001030565.2.59421 NP_001030565.2.76553 NP_001094766.1.59421 NP_001094766.1.76553 XP_005898548.1.15283 XP_005898549.1.15283 XP_014334539.1.15283 XP_014334540.1.15283 XP_019811099.1.53367 XP_019812068.1.53367 9913.ENSBTAP00000049572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]