SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049636 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049636
Domain Number 1 Region: 45-190
Classification Level Classification E-value
Superfamily EF-hand 7.97e-36
Family Calmodulin-like 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049636   Gene: ENSBTAG00000009707   Transcript: ENSBTAT00000054271
Sequence length 192
Comment pep:known chromosome:UMD3.1:2:98527573:98555234:-1 gene:ENSBTAG00000009707 transcript:ENSBTAT00000054271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKDVKKPAAAAAPAPAPAPAPAPAPAPPKEEKIDLSAIKIEFSKQQQDEFKEAFLLF
DRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMLQAISN
NKDQGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCI
NYEAFVKHIMSN
Download sequence
Identical sequences A0JNJ5
9913.ENSBTAP00000049636 ENSBTAP00000049636 ENSBTAP00000049636 NP_001073046.1.59421 NP_001073046.1.76553 XP_005202773.1.76553 XP_019831818.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]