SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049668 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049668
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily Lysozyme-like 1.27e-45
Family C-type lysozyme 0.0000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049668   Gene: ENSBTAG00000039170   Transcript: ENSBTAT00000056893
Sequence length 147
Comment pep:novel chromosome:UMD3.1:5:44502011:44507108:-1 gene:ENSBTAG00000039170 transcript:ENSBTAT00000056893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQALLNLGLLLLSVTVQGKKFQKCELARTLKRLGLDGYKGISLAKWVCLASWERSYNTCA
TNYNRGDKSSDYGIFQINSRRWCNDGKTPRAVNACRIPCSALLKDDITQAVASAKKVSDP
QGVRAWVVWRNKCQNQDLRSYVQDCGV
Download sequence
Identical sequences E1BBW5
ENSBTAP00000049668 ENSBTAP00000049668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]