SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049731 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049731
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily EF-hand 1.47e-58
Family Calmodulin-like 0.0000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049731   Gene: ENSBTAG00000032705   Transcript: ENSBTAT00000046448
Sequence length 149
Comment pep:known chromosome:UMD3.1:20:8066341:8067501:1 gene:ENSBTAG00000032705 transcript:ENSBTAT00000046448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQLTEEQIAEFQEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVHMMTAK
Download sequence
Identical sequences F1MLH6
NP_001159980.1.59421 NP_001159980.1.76553 XP_010851854.1.44457 XP_019838629.1.53367 ENSBTAP00000049731 ENSBTAP00000049731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]