SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049751 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049751
Domain Number 1 Region: 2-245
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.54e-82
Family Eukaryotic proteases 0.00067
Further Details:      
 
Domain Number 2 Region: 287-491
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.46e-49
Family Eukaryotic proteases 0.00065
Further Details:      
 
Domain Number 3 Region: 538-680
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-46
Family Eukaryotic proteases 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049751   Gene: ENSBTAG00000037821   Transcript: ENSBTAT00000054998
Sequence length 680
Comment pep:novel chromosome:UMD3.1:22:53260485:53287998:1 gene:ENSBTAG00000037821 transcript:ENSBTAT00000054998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSRIVGGRPAAEKKWPWQVSLQVNQKHICGGSLIGSRWVLTAAHCRIWEGSLCSHVEYTV
KMGITQLQQTSTMAVTVPVQDIVIHKHFNPIGIIENDIALALLAFPVNFSASIQPVCLPE
KAFMVQAGTECWVTGWGKVKEEDVPQASTQELQEAELNILRYETCNEVLSEKLESQFDVV
KEGTVCAISSKGKDACQGDSGGPLVCEFNNSWVQVGIVSWGIGCGRSGYPGVYTEVSFYK
DWLIARLSGLAKGPLLPDVDPSVRVQPLPHKPSWGRNCLVSDSELGPLARPRKWPWQVSL
QINNVHKCGGSLIAPRWVLTSAHCVRGSHYINGPQRDSSVNTVIAPSRASATLIKHIKSH
KDFDWNLTPNDIALLQLAHSVNYSAYIQPVCLPRKNFEVRPGTQCWITGWGRTLEFVGLA
RAALGGGWMMVKCSALKCHSQKPGPGEGPWCLSPQSFHSCQGDSGSPLVCQFQTSWIQVG
IFPITGPCASPFKGFFLAALHGWQLGLTAGLGLGDGSGSWGWSPGQRPVLTGCTPGLSQG
TCGHRKMRIIGGMPAPDRKWPWQVSLQINNEHVCGGSLIAPQWVLTAAHCIFGPVVRGLL
GFEEYTVRMGSTLLLPESGMVIPVRDIVCHSFYDVRTLINDIALVLLAHSVNYSAFIQPV
CLPEKNFEAETGTRCWVTGW
Download sequence
Identical sequences F1ML28
ENSBTAP00000049751 ENSBTAP00000049751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]