SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049864 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049864
Domain Number 1 Region: 13-121
Classification Level Classification E-value
Superfamily SRCR-like 5.1e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000709
Further Details:      
 
Domain Number 2 Region: 234-345
Classification Level Classification E-value
Superfamily SRCR-like 7.72e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 115-224
Classification Level Classification E-value
Superfamily SRCR-like 1.15e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049864   Gene: ENSBTAG00000039041   Transcript: ENSBTAT00000054941
Sequence length 416
Comment pep:known chromosome:UMD3.1:5:102722829:102726245:1 gene:ENSBTAG00000039041 transcript:ENSBTAT00000054941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPHCSIFLSSDSRLLRLVDGGGHCAGRVEILDQGSWGTICDDGWDLDDAHVVCRQLGCG
EALNATSSAHFGAGSGPIWLDDLNCTGNESHLWRCPSRGWGQHDCRHKEDAGVICSEFVA
FRMVSEDQQCAGWLEVFYNGTWGSVCRSPMEDITVSIICRQLGCGDSGSLNSSVALREGS
RPHWVDGIQCRKTDTSLWHCPSDFWNYNSCSPKEEAYISCAGRRPESCPTAAPCTDREKL
RLRGGDTECSGRVEVWHSGSWGTVCDDSWSLAEAEVVCQQLGCGQALEAMQAATFGPGNG
SIWLDEVRCRGQESSLWDCALEPWGQSDCKHEEDAGVRCSGARTTLPPSTAGTVSTGRRE
YSNTGDLFHGLFDSSGEEEPEEPWLVGEPGYYFGEIPCFGSRGQKVLMPGIQCTCI
Download sequence
Identical sequences F1MNY8
ENSBTAP00000049864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]