SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050126 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050126
Domain Number 1 Region: 7-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-78
Family Eukaryotic proteases 0.00000000625
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050126   Gene: ENSBTAG00000039813   Transcript: ENSBTAT00000051876
Sequence length 251
Comment pep:known chromosome:UMD3.1:21:35135771:35137852:1 gene:ENSBTAG00000039813 transcript:ENSBTAT00000051876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLLLLVALLSPTGEAGKIIGGHEAKPHSRPYMAFLLFKTSGKSHICGGFLVREDFVLT
AAHCLGSSINVTLGAHNIMERERTQQVIPVRRPIPHPDYNDETLANDIMLLKLTRKADIT
DKVSPINLPRSLAEVKPGMMCSVAGWGRLGVNMPSTDKLQEVDLEVQSEEKCIARFKNYI
PFTQICAGDPSKRKNSFSGDSGGPLVCNGVAQGIVSYGRNDGTTPDVYTRISSFLSWIHS
TMRRYKRQGSV
Download sequence
Identical sequences F1MEZ5
ENSBTAP00000050126 9913.ENSBTAP00000050126 XP_019839561.1.53367 XP_019839613.1.53367 ENSBTAP00000050126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]