SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050246 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050246
Domain Number 1 Region: 15-261
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.32e-86
Family Eukaryotic proteases 0.00000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050246   Gene: ENSBTAG00000039914   Transcript: ENSBTAT00000053990
Sequence length 263
Comment pep:known chromosome:UMD3.1:18:2607955:2611931:1 gene:ENSBTAG00000039914 transcript:ENSBTAT00000053990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLWVVLGFFLFGSSFGCGVPAIDPVLSGLSRIVNGEDAVPGSWPWQVSLQTSSGFHFC
GGSLISEDWVVTAAHCGVSKGTTFTSQPQDSGSGPPPSQYRRTAQVFEHPQWDLRAVRND
VALLKLAAPARLSAAVAPVCLPSADTSFPTGSLCTVTGWGKTRYNAFDTPDKLQQATLPI
LSNADCREFWGSKITDVMICAGASGISSCMGDSGGPLVCQKDGAWTLAGIVSWGSSRCSP
FLPGVYARVTKFIPWILEVLEAN
Download sequence
Identical sequences E1BDT3
ENSBTAP00000050246 ENSBTAP00000050246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]