SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050283 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050283
Domain Number 1 Region: 47-191
Classification Level Classification E-value
Superfamily EF-hand 1.97e-31
Family Calmodulin-like 0.00000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050283   Gene: ENSBTAG00000021916   Transcript: ENSBTAT00000057007
Sequence length 193
Comment pep:known chromosome:UMD3.1:19:46925386:46938601:1 gene:ENSBTAG00000021916 transcript:ENSBTAT00000057007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKPEPKKEVAKPATAPAASPAPPPEPLKEPAFDPKSVKVSYTSTYVTEFKEAFSLFD
RTPTGELKIAYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNSKMLDFETFLPILQHIS
RNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVEQLLAGQEDANGC
INYEAFVKHIMSG
Download sequence
Identical sequences F6RF62
ENSBTAP00000050283 ENSBTAP00000050283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]