SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050312 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000050312
Domain Number - Region: 24-142
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000182
Family G proteins 0.0076
Further Details:      
 
Domain Number - Region: 263-304
Classification Level Classification E-value
Superfamily Globin-like 0.0749
Family Globins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050312   Gene: ENSBTAG00000040368   Transcript: ENSBTAT00000055091
Sequence length 315
Comment pep:known chromosome:UMD3.1:10:13992197:14074945:-1 gene:ENSBTAG00000040368 transcript:ENSBTAT00000055091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVPCALVTSCSSTFSADRLVQHILGTEDVVVEVTANDAVRFYPWTIDNKYYSADINL
CVVPNKFLVTAEIAESVQAFVVYFDSTQKSGLDSVSSWLPLAESWLPEVMILVCDRVSEN
GVNRQKAQEWCIKHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNER
NQGLNLLSSLTGASHSIGSAESCHSEQPCVPAAERTESLLDHRGAASNTADVQVDSIVDP
MLDLDIQELASLTTGGGDLENFERLFSKLKEMKDKAATLPHEQRKMHAEKVAKAFWMAIG
GDRDEIEGLSSDEEH
Download sequence
Identical sequences A5PKE7
NP_001092366.1.59421 NP_001092366.1.76553 ENSBTAP00000050312 ENSBTAP00000050312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]