SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050393 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050393
Domain Number 1 Region: 166-418
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.42e-87
Family Eukaryotic proteases 0.0000403
Further Details:      
 
Domain Number 2 Region: 52-178
Classification Level Classification E-value
Superfamily SEA domain 3.14e-23
Family SEA domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050393   Gene: ENSBTAG00000038648   Transcript: ENSBTAT00000053208
Sequence length 419
Comment pep:novel chromosome:UMD3.1:6:85177921:85245141:-1 gene:ENSBTAG00000038648 transcript:ENSBTAT00000053208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGQPPQREQAWTPLQNRMDSNTKMKITRCGKISLCILTMVIAILVIGLIVCFVTYGKT
YFYHHISFKVNNIDYDSKFAKPYSQEYTDLNNKIISLINETFHGSRLRRQYVTSQVVQVS
QAKGKVIIHIVLKFKSYYTNTSAKFRDKIETILRQKLNGKTGSLCIDSSSFRFSGCGHRK
ITRSGNKIAGGMDAEEGEWPWQASLQQKNVHRCGATLISNSWLVTAAHCFLKARDPKQWN
VSFGLLLSDPQIQRSVKDIIIHENYHYPSHKNDIAVVRLSSPVLYTSNIRRACLPETSYA
FPSNSDVVVTGWGTLKTDGTSPNILQKGLVKIIDSKICNRKVVYDGAITPGMLCAGFLEG
SVDACQGDSGGPLVGEDYKGTWFLAGIVSWGDECALPNKPGVYTRVTHYRDWIMSKTGL
Download sequence
Identical sequences E1BL16
ENSBTAP00000050393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]