SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050406 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050406
Domain Number 1 Region: 121-623
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.28e-162
Family Calponin-homology domain, CH-domain 0.00000000211
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily EF-hand 4.75e-17
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050406   Gene: ENSBTAG00000011613   Transcript: ENSBTAT00000055249
Sequence length 630
Comment pep:known chromosome:UMD3.1:X:71709936:71806536:1 gene:ENSBTAG00000011613 transcript:ENSBTAT00000055249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKL
MLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHS
YSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDE
RAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLF
ADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSK
AYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVS
GNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLY
ADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVG
IGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVSWVNRTLNEAGKSTS
IQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGTLTEDDKHNNAKYAVSMARRIGARV
YALPEDLVEVKPKMVMTVFACLMGRGMKRV
Download sequence
Identical sequences A7E3Q8 W5Q6H1
ENSBTAP00000050406 ENSOARP00000018311 XP_005227971.1.76553 XP_005227972.1.76553 XP_005700622.1.57651 XP_005700623.1.57651 XP_005898592.1.15283 XP_005898593.1.15283 XP_005898594.1.15283 XP_006054314.1.26621 XP_006054315.1.26621 XP_011962885.1.66739 XP_011962886.1.66739 XP_014946623.1.54773 XP_019811482.1.53367 XP_019811483.1.53367 XP_020761212.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]