SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050453 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050453
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily Lysozyme-like 1.31e-51
Family C-type lysozyme 0.00000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050453   Gene: ENSBTAG00000020564   Transcript: ENSBTAT00000052851
Sequence length 147
Comment pep:known chromosome:UMD3.1:5:44533886:44559481:1 gene:ENSBTAG00000020564 transcript:ENSBTAT00000052851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLILGLLLLSVAVQGKTFKRCELARTLKNLGLAGYKGVSLADWMCLAKGESSYNTQA
KNFNRGSQSTDYGIFQINSKWWCNDGKTPNAVNGCGVSCSALLKDDITQAVACAKKIVSQ
QGLTAWVAWKNNCRNRDLTSYVQGCGV
Download sequence
Identical sequences F1MEC3
ENSBTAP00000050453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]