SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050470 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050470
Domain Number 1 Region: 18-250
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.33e-79
Family Eukaryotic proteases 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050470   Gene: ENSBTAG00000040177   Transcript: ENSBTAT00000053012
Sequence length 251
Comment pep:known chromosome:UMD3.1:18:57439359:57445450:-1 gene:ENSBTAG00000040177 transcript:ENSBTAT00000053012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGFLCALLSLLEGQGWADTRAIGAKECRPNSQPWQAGLFYLTHLFCGATLISDRWLLT
AAHCRKWYLWVRLGEHHLWKWEGPEQLFRATDFFPHPGFNQDLTAQDHNNDIMLVRLPRK
AHLGPAVQPLNLSQTCVSPGTQCLISGWGAVSSPKVEYPLTLQCANISILEPRLCRRAYP
GHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGSEPCSRPRRPAVYTSVCHY
LDWIQETMEDN
Download sequence
Identical sequences E1BJ72
ENSBTAP00000050470 ENSBTAP00000050470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]